AibGenesis™ Mouse Anti-PACRG Antibody (CBMOAB-53740FYA)
Cat: CBMOAB-53740FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-53740FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Human (Homo sapiens), Mouse (Mus musculus), Chicken (Gallus gallus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Marmoset | WB, ELISA | MO53740FYA | 100 µg | ||
| CBMOAB-91236FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO91236FYA | 100 µg | ||
| MO-AB-17455R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO17455R | 100 µg | ||
| MO-AB-60888W | Monoclonal | Marmoset | WB, ELISA | MO60888W | 100 µg | ||
| MO-DKB-03226W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Chicken (Gallus gallus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Human (Homo sapiens), Mouse (Mus musculus), Chicken (Gallus gallus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Marmoset |
| Clone | MO53740FYA |
| Specificity | This antibody binds to Rhesus PACRG. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus PACRG Antibody is a mouse antibody against PACRG. It can be used for PACRG detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | PACRG |
| UniProt ID | F6U149 |
| Protein Refseq | The length of the protein is 296 amino acids long. The sequence is show below: MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPTAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNGSHSSPRLECSGAIMARCHLDHLGSSDPPTSASQLVFLYMNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry