AibGenesis™ Mouse Anti-PAGE4 Antibody (CBMOAB-53766FYA)


Cat: CBMOAB-53766FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53766FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO53766FYA 100 µg
MO-AB-17497R Monoclonal Cattle (Bos taurus) WB, ELISA MO17497R 100 µg
MO-AB-60912W Monoclonal Marmoset WB, ELISA MO60912W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO53766FYA
SpecificityThis antibody binds to Rhesus PAGE4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer. It is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. The protein may play a role in benign and malignant prostate diseases. A related pseudogene is located on chromosome 7. Alternate splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus PAGE4 Antibody is a mouse antibody against PAGE4. It can be used for PAGE4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPAGE4
UniProt IDF7DSJ1
Protein RefseqThe length of the protein is 103 amino acids long.
The sequence is show below: MSARVRSRSRGRGDGQEAPDVFAFVAPGESQQEEPPTDNQDIEPGRERERTPPIEGERKVEGDCQEMDLENTGNERGDGSDVKEKTPPNPERAKTKEAGDGQP.
For Research Use Only | Not For Clinical Use.
Online Inquiry