Mouse Anti-PAICS Antibody (CBMOAB-53773FYA)


Cat: CBMOAB-53773FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53773FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO53773FYA 100 µg
CBMOAB-91277FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO91277FYA 100 µg
MO-AB-17503R Monoclonal Cattle (Bos taurus) WB, ELISA MO17503R 100 µg
MO-AB-20089W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20089W 100 µg
MO-AB-43337W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43337W 100 µg
MO-AB-60916W Monoclonal Marmoset WB, ELISA MO60916W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, Zebrafish (Danio rerio)
CloneMO53773FYA
SpecificityThis antibody binds to Rhesus PAICS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. The gene is closely linked and divergently transcribed with a locus that encodes an enzyme in the same pathway, and transcription of the two genes is coordinately regulated. The human genome contains several pseudogenes of this gene. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus PAICS Antibody is a mouse antibody against PAICS. It can be used for PAICS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPAICS
UniProt IDF7GPV6
Protein RefseqThe length of the protein is 421 amino acids long.
The sequence is show below: FISTVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKLCFAGLVIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYDLKEVTPERLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGAQDVWSSLRLPSGLGCSTILSPEGSAQFAAQIFGLNNHLVWSKLRASILNTWISLKQADKKIREC.
For Research Use Only | Not For Clinical Use.
Online Inquiry