AibGenesis™ Mouse Anti-PAQR5 Antibody (CBMOAB-53862FYA)


Cat: CBMOAB-53862FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53862FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO53862FYA 100 µg
MO-AB-04986W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04986W 100 µg
MO-AB-20286W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20286W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO53862FYA
SpecificityThis antibody binds to Rhesus PAQR5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PAQR5 Antibody is a mouse antibody against PAQR5. It can be used for PAQR5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPAQR5
UniProt IDF6TQ96
Protein RefseqThe length of the protein is 314 amino acids long.
The sequence is show below: QVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFAWRFVTALYVTDIKNDNYSWPMLVYMCTSCVYPLASSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDTLVCTTFHNYYVAMAVLNTVLSTGLSCYSRFLEIQKPRLCKVIRVLAFAYPYMWDSLPIFYRLFLFPGESAQNEATSYHQKHMIMTLLASFLYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHMQMEAILLDKTLRKEWLLATSKPFSFSQIAGAILLCIIFSLSNIIYFSAALYRIPKPELHKKET.
For Research Use Only | Not For Clinical Use.
Online Inquiry