AibGenesis™ Mouse Anti-PAQR7 Antibody (CBMOAB-53868FYA)


Cat: CBMOAB-53868FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53868FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO53868FYA 100 µg
MO-AB-03328Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03328Y 100 µg
MO-AB-12765W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12765W 100 µg
MO-AB-17543R Monoclonal Cattle (Bos taurus) WB, ELISA MO17543R 100 µg
MO-AB-60989W Monoclonal Marmoset WB, ELISA MO60989W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO53868FYA
SpecificityThis antibody binds to Rhesus PAQR7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PAQR7 Antibody is a mouse antibody against PAQR7. It can be used for PAQR7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMembrane progestin receptor alpha; PAQR7
UniProt IDI2CVK1
Protein RefseqThe length of the protein is 346 amino acids long.
The sequence is show below: MAMAQKLSHLLPSLRQVIQEPQLSLQPEPIFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLALFVETVDFWGDPHALPLFIIVLASFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPSWHARVQAVFLPMAAFLAWLSCTGSCYNKYIQKPGLLGRTCQEVPSALAYALDISPVVHRIFVSSDPAIDDPALLYHKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHIFLVLCTLAQLEAVALDYEARRPIYEPLHTHWPHNFSGLFLLTVGSSVLTAFLLSQLVQRRLDQKTK.
For Research Use Only | Not For Clinical Use.
Online Inquiry