AibGenesis™ Mouse Anti-PATE4 Antibody (MO-AB-05012W)


Cat: MO-AB-05012W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05012W Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO05012W 100 µg
Inquiry
MO-AB-27732H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27732C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO05012W
SpecificityThis antibody binds to Rhesus PATE4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PATE4 Antibody is a mouse antibody against PATE4. It can be used for PATE4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProstate And Testis Expressed 4; PATE-Like Protein B; PATE-B; Prostate And Testis Expressed Protein 4; Prostate And Testis Expression B
UniProt IDG7NCX6
Protein RefseqThe length of the protein is 98 amino acids long.
The sequence is show below: MRKMNTLLLVSLSFLYLKEVMGLKCNTCIHTEGWKCMAGRGTCIAKENELCSTTAYFRGNKHMYSTQMCKYKCKEEKYSKRGLLRVTLCCDRNFCNIF.
For Research Use Only | Not For Clinical Use.
Online Inquiry