AibGenesis™ Mouse Anti-PCBD2 Antibody (CBMOAB-53986FYA)


Cat: CBMOAB-53986FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53986FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO53986FYA 100 µg
MO-AB-03356Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03356Y 100 µg
MO-AB-06059H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06059C 100 µg
MO-AB-11227W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11227W 100 µg
MO-AB-27745H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27745C 100 µg
MO-AB-61057W Monoclonal Marmoset WB, ELISA MO61057W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO53986FYA
SpecificityThis antibody binds to Rhesus PCBD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PCBD2 Antibody is a mouse antibody against PCBD2. It can be used for PCBD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPCBD2
UniProt IDF7BHL7
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: MAAALWARGATRRLLAALQGQSLLAAVSSGTHRLTAEERNHAILDLKAAGWSELSERDAIYKEFSFHSFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV.
For Research Use Only | Not For Clinical Use.
Online Inquiry