Mouse Anti-PCCA Antibody (CBMOAB-53998FYA)


Cat: CBMOAB-53998FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53998FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO53998FYA 100 µg
CBMOAB-91619FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO91619FYA 100 µg
MO-AB-06065H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06065C 100 µg
MO-AB-12067W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12067W 100 µg
MO-AB-17598R Monoclonal Cattle (Bos taurus) WB, ELISA MO17598R 100 µg
MO-AB-61069W Monoclonal Marmoset WB, ELISA MO61069W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO53998FYA
SpecificityThis antibody binds to Rhesus PCCA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is the alpha subunit of the heterodimeric mitochondrial enzyme Propionyl-CoA carboxylase. PCCA encodes the biotin-binding region of this enzyme. Mutations in either PCCA or PCCB (encoding the beta subunit) lead to an enzyme deficiency resulting in propionic acidemia. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus PCCA Antibody is a mouse antibody against PCCA. It can be used for PCCA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPCCA
UniProt IDF7HD56
Protein RefseqThe length of the protein is 146 amino acids long.
The sequence is show below: NISLCPEICFQKIESQVYFVRVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNYVIRGVTHNIALLREVIINSRFVKGDISTKFLSDVYPDGFKGHMLTKSEKNQLLAIASSLFVAFQLRAQHFQENSRWKLMGRN.
For Research Use Only | Not For Clinical Use.
Online Inquiry