AibGenesis™ Mouse Anti-PCDHB5 Antibody (CBMOAB-54011FYA)


Cat: CBMOAB-54011FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54011FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO54011FYA 100 µg
MO-AB-16873W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16873W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO54011FYA
SpecificityThis antibody binds to Rhesus PCDHB5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections. (From NCBI)
Product OverviewMouse Anti-Rhesus PCDHB5 Antibody is a mouse antibody against PCDHB5. It can be used for PCDHB5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtocadherin beta-5; PCDHB5
UniProt IDH9F283
Protein RefseqThe length of the protein is 48 amino acids long.
The sequence is show below: YQYEVCLTGDPGTGEFKFLKPIIPNLLPQGTGEEIGKTAAFRNNFGLN.
For Research Use Only | Not For Clinical Use.
Online Inquiry