AibGenesis™ Mouse Anti-PCDHB5 Antibody (CBMOAB-54011FYA)
Cat: CBMOAB-54011FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) |
| Clone | MO54011FYA |
| Specificity | This antibody binds to Rhesus PCDHB5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus PCDHB5 Antibody is a mouse antibody against PCDHB5. It can be used for PCDHB5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protocadherin beta-5; PCDHB5 |
| UniProt ID | H9F283 |
| Protein Refseq | The length of the protein is 48 amino acids long. The sequence is show below: YQYEVCLTGDPGTGEFKFLKPIIPNLLPQGTGEEIGKTAAFRNNFGLN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry