AibGenesis™ Mouse Anti-PCGF3 Antibody (CBMOAB-54019FYA)


Cat: CBMOAB-54019FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54019FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO54019FYA 100 µg
MO-AB-17614R Monoclonal Cattle (Bos taurus) WB, ELISA MO17614R 100 µg
MO-AB-20378W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20378W 100 µg
MO-AB-27755H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27755C 100 µg
MO-AB-61120W Monoclonal Marmoset WB, ELISA MO61120W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO54019FYA
SpecificityThis antibody binds to Rhesus PCGF3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains a C3HC4 type RING finger, which is a motif known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. (From NCBI)
Product OverviewMouse Anti-Rhesus PCGF3 Antibody is a mouse antibody against PCGF3. It can be used for PCGF3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPCGF3
UniProt IDF7F0K1
Protein RefseqThe length of the protein is 247 amino acids long.
The sequence is show below: LQKPKMLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry