AibGenesis™ Mouse Anti-PDE6C Antibody (CBMOAB-54135FYA)


Cat: CBMOAB-54135FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54135FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio) WB, ELISA MO54135FYA 100 µg
CBMOAB-92015FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92015FYA 100 µg
MO-AB-03369Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03369Y 100 µg
MO-AB-17684R Monoclonal Cattle (Bos taurus) WB, ELISA MO17684R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio)
CloneMO54135FYA
SpecificityThis antibody binds to Rhesus PDE6C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the alpha-prime subunit of cone phosphodiesterase, which is composed of a homodimer of two alpha-prime subunits and 3 smaller proteins of 11, 13, and 15 kDa. Mutations in this gene are associated with cone dystrophy type 4 (COD4). (From NCBI)
Product OverviewMouse Anti-Rhesus PDE6C Antibody is a mouse antibody against PDE6C. It can be used for PDE6C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha'; PDE6C
UniProt IDH9FJF2
Protein RefseqThe length of the protein is 310 amino acids long.
The sequence is show below: EKFKVPVEVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAFCHDIDHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFETVIHLFEVAIIATDLALYFKKRTMFQKIVDACEQMQTEEEAIKYVTVDPTKKEIIMAMMMTACDLSAITKPWEVQSQVALMVANEFWEQGDLERTVLQQQPIPMMDRNKRDELPKLQVGFIDFVCTFVYKEFSRFHKEITPMLSGLQNNRVEWKSLADEYDAKMKVIEEEAKKQEEGAEKAAEDSG.
For Research Use Only | Not For Clinical Use.
Online Inquiry