Mouse Anti-PDSS2 Antibody (CBMOAB-54216FYA)
Cat: CBMOAB-54216FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-54216FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO54216FYA | 100 µg | ||
| CBMOAB-92130FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO92130FYA | 100 µg | ||
| MO-AB-02929W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02929W | 100 µg | ||
| MO-AB-03389Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03389Y | 100 µg | ||
| MO-AB-17737R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO17737R | 100 µg | ||
| MO-AB-20957W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20957W | 100 µg | ||
| MO-AB-28198R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28198R | 100 µg | ||
| MO-AB-61266W | Monoclonal | Marmoset | WB, ELISA | MO61266W | 100 µg | ||
| MO-DKB-01434W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio) |
| Clone | MO54216FYA |
| Specificity | This antibody binds to Rhesus PDSS2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is an enzyme that synthesizes the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. Defects in this gene are a cause of coenzyme Q10 deficiency. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus PDSS2 Antibody is a mouse antibody against PDSS2. It can be used for PDSS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | PDSS2 |
| UniProt ID | F7GHD4 |
| Protein Refseq | The length of the protein is 212 amino acids long. The sequence is show below: MNLRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGQSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSRNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSGIYSCQRSLAEITELIHTALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTKSF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry