AibGenesis™ Mouse Anti-PHF5A Antibody (CBMOAB-54441FYA)
Cat: CBMOAB-54441FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-54441FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Silkworm (Bombyx mori), Zebrafish (Danio rerio) | WB, ELISA | MO54441FYA | 100 µg | ||
| CBMOAB-92445FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO92445FYA | 100 µg | ||
| MO-AB-06234H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06234C | 100 µg | ||
| MO-AB-12431W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12431W | 100 µg | ||
| MO-AB-17870R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO17870R | 100 µg | ||
| MO-AB-27853H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27853C | 100 µg | ||
| MO-AB-46027W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46027W | 100 µg | ||
| MO-AB-61438W | Monoclonal | Marmoset | WB, ELISA | MO61438W | 100 µg | ||
| MO-AB-70236W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70236W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Silkworm (Bombyx mori), Zebrafish (Danio rerio) |
| Clone | MO54441FYA |
| Specificity | This antibody binds to Rhesus PHF5A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus PHF5A Antibody is a mouse antibody against PHF5A. It can be used for PHF5A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | PHD finger-like domain-containing protein 5A; PHF5A |
| UniProt ID | H9EQL3 |
| Protein Refseq | The length of the protein is 110 amino acids long. The sequence is show below: MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry