AibGenesis™ Mouse Anti-PHLDB3 Antibody (CBMOAB-54468FYA)


Cat: CBMOAB-54468FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54468FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO54468FYA 100 µg
MO-AB-17878R Monoclonal Cattle (Bos taurus) WB, ELISA MO17878R 100 µg
MO-AB-61465W Monoclonal Marmoset WB, ELISA MO61465W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO54468FYA
SpecificityThis antibody binds to Rhesus PHLDB3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PHLDB3 Antibody is a mouse antibody against PHLDB3. It can be used for PHLDB3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPHLDB3
UniProt IDH9H3Y5
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: QQAMAERERLLKAREGTRRGTEASSGPAVPAITAPPTPPHPPGPRILDLRQHLEAWGHNPENCPHVQVSGGCCRGPLVKMGGRIKTWRKRWFCFDRQARRLAYYADKEETKLKGVIYFQAIEEVYYDHLRCAFKSPSPRLTFCVKTYERLFYMVAPSPEAMRIWMDVIVTAADENHAP.
For Research Use Only | Not For Clinical Use.
Online Inquiry