AibGenesis™ Mouse Anti-PI4K2A Antibody (CBMOAB-54501FYA)


Cat: CBMOAB-54501FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54501FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO54501FYA 100 µg
CBMOAB-92520FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92520FYA 100 µg
MO-AB-14801W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14801W 100 µg
MO-AB-17889R Monoclonal Cattle (Bos taurus) WB, ELISA MO17889R 100 µg
MO-AB-37956W Monoclonal Goat (Capra hircus) WB, ELISA MO37956W 100 µg
MO-AB-61485W Monoclonal Marmoset WB, ELISA MO61485W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Zebrafish (Danio rerio)
CloneMO54501FYA
SpecificityThis antibody binds to Rhesus PI4K2A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PI4K2A Antibody is a mouse antibody against PI4K2A. It can be used for PI4K2A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhosphatidylinositol 4-kinase type 2-alpha; PI4K2A
UniProt IDH9F9F3
Protein RefseqThe length of the protein is 436 amino acids long.
The sequence is show below: SGPSPPGSPGHDRERQPLLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPRFEAVVRQAELAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW.
For Research Use Only | Not For Clinical Use.
Online Inquiry