AibGenesis™ Mouse Anti-PI4K2B Antibody (CBMOAB-54502FYA)


Cat: CBMOAB-54502FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54502FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO54502FYA 100 µg
CBMOAB-92522FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92522FYA 100 µg
MO-AB-15754W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15754W 100 µg
MO-AB-17890R Monoclonal Cattle (Bos taurus) WB, ELISA MO17890R 100 µg
MO-AB-61486W Monoclonal Marmoset WB, ELISA MO61486W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO54502FYA
SpecificityThis antibody binds to Rhesus PI4K2B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the type II PI4 kinase protein family. The encoded protein is primarily cytosolic and contributes to overall PI4-kinase activity along with other protein family members. This protein is involved in early T cell activation. (From NCBI)
Product OverviewMouse Anti-Rhesus PI4K2B Antibody is a mouse antibody against PI4K2B. It can be used for PI4K2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhosphatidylinositol 4-kinase type 2-beta; PI4K2B
UniProt IDH9FHL6
Protein RefseqThe length of the protein is 93 amino acids long.
The sequence is show below: AVSVTTGTSEMNAFLDDPEFADIILRAEQAIEVGIFPERISQGSSGSYFVKDPKRKIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGC.
For Research Use Only | Not For Clinical Use.
Online Inquiry