Mouse Anti-PIGX Antibody (CBMOAB-54546FYA)


Cat: CBMOAB-54546FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54546FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO54546FYA 100 µg
CBMOAB-92608FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92608FYA 100 µg
MO-AB-05142W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05142W 100 µg
MO-AB-06269H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06269C 100 µg
MO-AB-27875H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27875C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO54546FYA
SpecificityThis antibody binds to Rhesus PIGX.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a type I transmembrane protein in the endoplasmic reticulum (ER). The protein is an essential component of glycosylphosphatidylinositol-mannosyltransferase I, which transfers the first of the four mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Studies in rat indicate that the protein is translated from a non-AUG translation initiation site. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus PIGX Antibody is a mouse antibody against PIGX. It can be used for PIGX detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPIGX
UniProt IDF7GXA8
Protein RefseqThe length of the protein is 228 amino acids long.
The sequence is show below: MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLQTCRLLIKQDIPAGLFVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARQDSQCVDCFQAFLPVHYRYHRPHSHDGETSIVVNHPDLLMFCDQGEGCRCFLRVRKWAFQDTIPRELLRCWSQQRSHSVAQYVNNKVLKAIWDDMHFKCVYKNVTLQVPVGLTIHTSLVCSVTLFVTILCSTLILV.
For Research Use Only | Not For Clinical Use.
Online Inquiry