AibGenesis™ Mouse Anti-PIH1D3 Antibody (CBMOAB-54549FYA)


Cat: CBMOAB-54549FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54549FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO54549FYA 100 µg
CBMOAB-92616FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92616FYA 100 µg
MO-AB-61530W Monoclonal Marmoset WB, ELISA MO61530W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO54549FYA
SpecificityThis antibody binds to Rhesus PIH1D3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PIH1D3 Antibody is a mouse antibody against PIH1D3. It can be used for PIH1D3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPIH1D3
UniProt IDF7EJN6
Protein RefseqThe length of the protein is 209 amino acids long.
The sequence is show below: MESENMDSENMETENMDFESVSSVTALEALSKLLNPEEEDDSDCGQTKGLSTIGAMGPGNIGPPQIEELKVIPETSEENNDDIWNSEEVPEGAEHDDMWDVREIPEYEIIFRQQVGTEDIFLGLSRKDSSTSCCSELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPELVECASAKAFYIPETETLEITMTMKRELDIANFF.
For Research Use Only | Not For Clinical Use.
Online Inquiry