AibGenesis™ Mouse Anti-PKIB Antibody (CBMOAB-54630FYA)


Cat: CBMOAB-54630FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54630FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO54630FYA 100 µg
CBMOAB-92751FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92751FYA 100 µg
MO-AB-17975R Monoclonal Cattle (Bos taurus) WB, ELISA MO17975R 100 µg
MO-AB-27894H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27894C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO54630FYA
SpecificityThis antibody binds to Rhesus PKIB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PKIB Antibody is a mouse antibody against PKIB. It can be used for PKIB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamescAMP-dependent protein kinase inhibitor beta; PKIB
UniProt IDH9FWZ0
Protein RefseqThe length of the protein is 78 amino acids long.
The sequence is show below: MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEETTQDQLEKPQNEEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry