AibGenesis™ Mouse Anti-PLD6 Antibody (CBMOAB-54737FYA)
Cat: CBMOAB-54737FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-54737FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO54737FYA | 100 µg | ||
| CBMOAB-92916FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO92916FYA | 100 µg | ||
| MO-AB-18057R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO18057R | 100 µg | ||
| MO-AB-27923H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27923C | 100 µg | ||
| MO-AB-32749W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO32749W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO54737FYA |
| Specificity | This antibody binds to Rhesus PLD6. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Endonuclease that plays a critical role in PIWI-interacting RNA (piRNA) biogenesis during spermatogenesis. piRNAs provide essential protection against the activity of mobile genetic elements. piRNA-mediated transposon silencing is thus critical for maintaining genome stability, in particular in germline cells when transposons are mobilized as a consequence of wide-spread genomic demethylation. Has been proposed to act as a cardiolipin hydrolase to generate phosphatidic acid at mitochondrial surface. Although it cannot be excluded that it can act as a phospholipase in some circumstances, it should be noted that cardiolipin hydrolase activity is either undetectable in vitro, or very low. In addition, cardiolipin is almost exclusively found on the inner mitochondrial membrane, while PLD6 localizes to the outer mitochondrial membrane, facing the cytosol. Has been shown to be a backbone-non-specific, single strand-specific nuclease, cleaving either RNA or DNA substrates with similar affinity. Produces 5'' phosphate and 3'' hydroxyl termini, suggesting it could directly participate in the processing of primary piRNA transcripts. Also acts as a regulator of mitochondrial shape through facilitating mitochondrial fusion. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Rhesus PLD6 Antibody is a mouse antibody against PLD6. It can be used for PLD6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Mitochondrial cardiolipin hydrolase; PLD6 |
| UniProt ID | I2CWM1 |
| Protein Refseq | The length of the protein is 224 amino acids long. The sequence is show below: MGRLRWQVAAAAAMGLALALEALPGVLRWLRSRRRRPRREVLFFPSQVTCTEALLRAPGAALAELPEGCPCGLPHGESALSRLLRALLAARASLELCLFAFSSPQLGRAVQLLHQRGVRVRVVTDCDYMALNGSQIGLLRKAGIQVRHDQDLGYMHHKFAIVDKRVLITGSLNWTTQAIQNNRENVLIMEDDEYVRLFLEEFERIWEEFNPTKYTFFPQKKKSH. |
For Research Use Only | Not For Clinical Use.
Online Inquiry