AibGenesis™ Mouse Anti-PLIN5 Antibody (CBMOAB-54815FYA)


Cat: CBMOAB-54815FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54815FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Marmoset, Pig (Sus scrofa) WB, ELISA MO54815FYA 100 µg
MO-AB-18088R Monoclonal Cattle (Bos taurus) WB, ELISA MO18088R 100 µg
MO-AB-23495W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23495W 100 µg
MO-AB-28391R Monoclonal Pig (Sus scrofa) WB, ELISA MO28391R 100 µg
MO-AB-32759W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32759W 100 µg
MO-AB-35445W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35445W 100 µg
MO-AB-61757W Monoclonal Marmoset WB, ELISA MO61757W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Marmoset, Pig (Sus scrofa)
CloneMO54815FYA
SpecificityThis antibody binds to Rhesus PLIN5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PLIN5 Antibody is a mouse antibody against PLIN5. It can be used for PLIN5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPLIN5
UniProt IDF7HCW0
Protein RefseqThe length of the protein is 138 amino acids long.
The sequence is show below: SPDPAAHIPRPSGSDSQTQQNVVQRVVALPLVRATCTAVCDAYSTAKDRHPLLGSACRLAENCVCGLTTRALDHAQPLLEHLQPQLASVNSFACRGLDKLEEKLPFLQQPSETVPQITRHGDLQWGQARAEVGGRKGW.
For Research Use Only | Not For Clinical Use.
Online Inquiry