AibGenesis™ Mouse Anti-PLPP1 Antibody (MO-AB-05214W)


Cat: MO-AB-05214W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05214W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Pig (Sus scrofa) WB, ELISA MO05214W 100 µg
MO-AB-06335H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06335C 100 µg
MO-AB-18104R Monoclonal Cattle (Bos taurus) WB, ELISA MO18104R 100 µg
MO-AB-28401R Monoclonal Pig (Sus scrofa) WB, ELISA MO28401R 100 µg
MO-AB-42342W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42342W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Pig (Sus scrofa)
CloneMO05214W
SpecificityThis antibody binds to Rhesus PLPP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMagnesium-independent phospholipid phosphatase of the plasma membrane that catalyzes the dephosphorylation of a variety of glycerolipid and sphingolipid phosphate esters including phosphatidate/PA, lysophosphatidate/LPA, diacylglycerol pyrophosphate/DGPP, sphingosine 1-phosphate/S1P and ceramide 1-phosphate/C1P (PubMed:18215144). Also acts on N-oleoyl ethanolamine phosphate/N-(9Z-octadecenoyl)-ethanolamine phosphate, a potential physiological compound. Through its extracellular phosphatase activity allows both the hydrolysis and the cellular uptake of these bioactive lipid mediators from the milieu, regulating signal transduction in different cellular processes. It is for instance essential for the extracellular hydrolysis of S1P and subsequent conversion into intracellular S1P. Involved in the regulation of inflammation, platelets activation, cell proliferation and migration among other processes. May also have an intracellular activity to regulate phospholipid-mediated signaling pathways. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus PLPP1 Antibody is a mouse antibody against PLPP1. It can be used for PLPP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPLPP1
UniProt IDF7GWM4
Protein RefseqThe length of the protein is 296 amino acids long.
The sequence is show below: MRRDFPKIRLVCLDRNKGKDIFIYSLLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIIYTGEILVIIYHILESDSFLVTNFYILDLYLTENVFTKGVGGGQGREEICKKSVARMIPQTLAICISSWIKSNFFFVYLLHTFCHMKEKLWRVGRRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAVLVAVYVSDFFKERTSFKERKEEDSHTTLHETSTTGNHYQSNHQP.
For Research Use Only | Not For Clinical Use.
Online Inquiry