Mouse Anti-PNKD Antibody (CBMOAB-54903FYA)


Cat: CBMOAB-54903FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54903FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO54903FYA 100 µg
CBMOAB-93121FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93121FYA 100 µg
MO-AB-05245W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05245W 100 µg
MO-AB-14430W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14430W 100 µg
MO-AB-18148R Monoclonal Cattle (Bos taurus) WB, ELISA MO18148R 100 µg
MO-AB-27947H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27947C 100 µg
MO-AB-32775W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32775W 100 µg
MO-AB-37969W Monoclonal Goat (Capra hircus) WB, ELISA MO37969W 100 µg
MO-AB-61841W Monoclonal Marmoset WB, ELISA MO61841W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO54903FYA
SpecificityThis antibody binds to Rhesus PNKD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PNKD Antibody is a mouse antibody against PNKD. It can be used for PNKD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPNKD
UniProt IDF6UP68
Protein RefseqThe length of the protein is 361 amino acids long.
The sequence is show below: MAWQGWSAPWQWVAGCWLLLVLVLVLLVSPRGCRVRRGLRGLLMAHSQRLLFRIGYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPGPTGDDDCSRAQLLEELRRLKDMHKSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry