AibGenesis™ Mouse Anti-PRODH2 Antibody (CBMOAB-55367FYA)


Cat: CBMOAB-55367FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55367FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO55367FYA 100 µg
MO-AB-18587R Monoclonal Cattle (Bos taurus) WB, ELISA MO18587R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO55367FYA
SpecificityThis antibody binds to Rhesus PRODH2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRODH2 Antibody is a mouse antibody against PRODH2. It can be used for PRODH2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPRODH2
UniProt IDF7AXN5
Protein RefseqThe length of the protein is 485 amino acids long.
The sequence is show below: GPLARGWQPLSFDGGAFHLKGTGELTRALLVLRLCAWPPLVTHGLALQAWSQRLLGSRLSGAFLRASVYGQFVAGETAEEVRGCVQQLRTLSLRPLLAVPTEEEPDSAAKSGKGLRRSGPDACWLGSEAWYEGNLGAMLRCVDLSRDLLEPPSLAEASLMQLKVTALTSARLLFAEHLSCSRHGARGRGGVKAKSLTSRHFLASQGQETIIKTKVRIPALWEAKPGQYSKTLSQQNKTKIIAPLSEVKVGGSLENLQVSCLNDEQNQHLQASLSRLHRVAQVTPPAGVWLHCPCWTPRTLTAVSYARAQHVRLLVDAEYTSLNPALSLLVAALAVRWNSPGEGGPWVWNTYQACLKDTFERLGRDAEAAHRAGLAFGVKLVRGAYLDKERAVAQLHGMKDPTQPDYEATSELNRASPFSYSRCLELMLTRVARHGPMCHLMVASHNEESVRQATKRMWELGIPLDGTVCFGQLLGMCDHVSLALG.
For Research Use Only | Not For Clinical Use.
Online Inquiry