AibGenesis™ Mouse Anti-PRPSAP1 Antibody (CBMOAB-55423FYA)


Cat: CBMOAB-55423FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55423FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO55423FYA 100 µg
CBMOAB-94141FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94141FYA 100 µg
MO-AB-06604H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06604C 100 µg
MO-AB-18637R Monoclonal Cattle (Bos taurus) WB, ELISA MO18637R 100 µg
MO-AB-21564W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21564W 100 µg
MO-AB-62368W Monoclonal Marmoset WB, ELISA MO62368W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO55423FYA
SpecificityThis antibody binds to Rhesus PRPSAP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRPSAP1 Antibody is a mouse antibody against PRPSAP1. It can be used for PRPSAP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPRPSAP1
UniProt IDF7EXR2
Protein RefseqThe length of the protein is 356 amino acids long.
The sequence is show below: MNAARTGYRVFSANSTAACTELAKRITERLGAELGKSVVYQETXXETRVEIKESVRGQDIFIIQTIPRDVNTAVMELLIMAYALKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEIQGFFSFPVDNLRASPFLLQYIQEEIPNYRNAVIVAKSPDAAKRAQSYAERLRLGLAVIHGEAQCTELDMDDGRHSPPMVKNATVHPGLELPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKERGAYKIYVMATHGILSAEAPRLIEESSVDEVVVTNTVPHEVQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFRNITVDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry