AibGenesis™ Mouse Anti-PRR4 Antibody (CBMOAB-55455FYA)


Cat: CBMOAB-55455FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55455FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO55455FYA 100 µg
MO-AB-28106H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28106C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO55455FYA
SpecificityThis antibody binds to Rhesus PRR4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRR4 Antibody is a mouse antibody against PRR4. It can be used for PRR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPRR4
UniProt IDF7BBZ6
Protein RefseqThe length of the protein is 134 amino acids long.
The sequence is show below: MLLVLLSVVLLALSSAQSTDNDVISEDFTPTTPDVEDSSQSPDQGPQRPPPEGLLPRLPGDSCNQDDGPQQRPPQPGGHHRYPLPLPFQNQRRRPQRTDLHRPLPRLPPVRLEEVPAFFQGDKPPRHLQDQPRW.
For Research Use Only | Not For Clinical Use.
Online Inquiry