AibGenesis™ Mouse Anti-PRSS12 Antibody (CBMOAB-55492FYA)


Cat: CBMOAB-55492FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55492FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO55492FYA 100 µg
CBMOAB-94176FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94176FYA 100 µg
MO-AB-25418W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25418W 100 µg
MO-AB-28619R Monoclonal Pig (Sus scrofa) WB, ELISA MO28619R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO55492FYA
SpecificityThis antibody binds to Rhesus PRSS12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRSS12 Antibody is a mouse antibody against PRSS12. It can be used for PRSS12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNeurotrypsin; PRSS12
UniProt IDH9F5L2
Protein RefseqThe length of the protein is 143 amino acids long.
The sequence is show below: QGPEEQCARFSSHVLPACLPFWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWAVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry