AibGenesis™ Mouse Anti-PRSS35 Antibody (CBMOAB-55504FYA)


Cat: CBMOAB-55504FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55504FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO55504FYA 100 µg
CBMOAB-94180FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94180FYA 100 µg
MO-AB-16406W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16406W 100 µg
MO-AB-18667R Monoclonal Cattle (Bos taurus) WB, ELISA MO18667R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO55504FYA
SpecificityThis antibody binds to Rhesus PRSS35.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRSS35 Antibody is a mouse antibody against PRSS35. It can be used for PRSS35 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInactive serine protease 35; PRSS35
UniProt IDH9FEG8
Protein RefseqThe length of the protein is 71 amino acids long.
The sequence is show below: KQSGGGQRVSEGRPSFRWTRVKNTHIPKGWARGGMGDAALDYDYALLELKRAHKKKYMELGISPTIKKMPG.
For Research Use Only | Not For Clinical Use.
Online Inquiry