Mouse Anti-PRTFDC1 Antibody (CBMOAB-55522FYA)


Cat: CBMOAB-55522FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55522FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO55522FYA 100 µg
CBMOAB-94185FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94185FYA 100 µg
MO-AB-12275W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12275W 100 µg
MO-AB-28122H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28122C 100 µg
MO-AB-62412W Monoclonal Marmoset WB, ELISA MO62412W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO55522FYA
SpecificityThis antibody binds to Rhesus PRTFDC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRTFDC1 Antibody is a mouse antibody against PRTFDC1. It can be used for PRTFDC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPRTFDC1
UniProt IDF6YAZ3
Protein RefseqThe length of the protein is 224 amino acids long.
The sequence is show below: MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKVYCIDDVVGTGRTMKALLSNIEKYKPNMVKVASLLVKRTPRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV.
For Research Use Only | Not For Clinical Use.
Online Inquiry