AibGenesis™ Mouse Anti-PSTK Antibody (CBMOAB-55618FYA)


Cat: CBMOAB-55618FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55618FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis) WB, ELISA MO55618FYA 100 µg
MO-AB-06681H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06681C 100 µg
MO-AB-18762R Monoclonal Cattle (Bos taurus) WB, ELISA MO18762R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis)
CloneMO55618FYA
SpecificityThis antibody binds to Rhesus PSTK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PSTK Antibody is a mouse antibody against PSTK. It can be used for PSTK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPSTK
UniProt IDF7DPY4
Protein RefseqThe length of the protein is 348 amino acids long.
The sequence is show below: MKTAENTRGTGSDGPRKQVLCVLCGLPAAGKSTFARALAHRLRQEQGWAVGVVAYDDVMPDAFLAGPRARPAPSQWKLLRQELLKYLEYFLMAVINGCQMSVPPSRTEAMWEDFITCLKDQDLIFSAAYAAQSCYLLTKTAVSRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNSQRPQALPPETIHLMGRKLEKPNPEKNAWEHNSLTIPSPACASEASLEVTDLLLTALENPVKCAEDNMEQKETARIICSTNILHKADQTLRRIVSQTMKGAKGMMCQLCVELMTFKQRWERANHAAIWRIILGNEHIKCRSRGWLDCCGIEKRPLSMG.
For Research Use Only | Not For Clinical Use.
Online Inquiry