Mouse Anti-PTAFR Antibody (CBMOAB-55627FYA)


Cat: CBMOAB-55627FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55627FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Goat (Capra hircus) WB, ELISA MO55627FYA 100 µg
MO-AB-06685H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06685C 100 µg
MO-AB-18764R Monoclonal Cattle (Bos taurus) WB, ELISA MO18764R 100 µg
MO-AB-38078W Monoclonal Goat (Capra hircus) WB, ELISA MO38078W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Goat (Capra hircus)
CloneMO55627FYA
SpecificityThis antibody binds to Rhesus PTAFR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionReceptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth-muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol-calcium second messenger system. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus PTAFR Antibody is a mouse antibody against PTAFR. It can be used for PTAFR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPlatelet-activating factor receptor; PTAFR
UniProt IDH9FG80
Protein RefseqThe length of the protein is 125 amino acids long.
The sequence is show below: WIFPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVTRPIKTAQANTRKRGISLSLVIWVAIVGAASYFFILDSTNTVPNSAGSGNITRCFEHYEKGSVPVLIIHIFIVFSFFLVFLIILFCNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry