AibGenesis™ Mouse Anti-PTDSS1 Antibody (CBMOAB-55658FYA)


Cat: CBMOAB-55658FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55658FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO55658FYA 100 µg
CBMOAB-94381FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94381FYA 100 µg
MO-AB-02989W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02989W 100 µg
MO-AB-06693H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06693C 100 µg
MO-AB-13521W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13521W 100 µg
MO-AB-18772R Monoclonal Cattle (Bos taurus) WB, ELISA MO18772R 100 µg
MO-AB-43385W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43385W 100 µg
MO-AB-62524W Monoclonal Marmoset WB, ELISA MO62524W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Marmoset, Zebrafish (Danio rerio)
CloneMO55658FYA
SpecificityThis antibody binds to Rhesus PTDSS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In membranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus PTDSS1 Antibody is a mouse antibody against PTDSS1. It can be used for PTDSS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPTDSS1
UniProt IDF6ZWH1
Protein RefseqThe length of the protein is 327 amino acids long.
The sequence is show below: MEYAVNCHVITWERIISHFDIFAFGHFWGWAMKALLIRSYGLCWTISITWELTELFFMHLLPNFAECWWDQVILDILLCNGGGIWLGMVVCRFLEMRTYHWASFKDIHTTTGKIKRAVLQFTPASWTYVRWFDPKSSFQRVAGVYLFMIIWQLTELNTFFLKHIFVFQASHPLSWGRILFIGGITAPTVRQYYAYLTDTQCKRVGTQCWVFGVIGFLEAIVCIKFGQDLFSKTQILYVVLWLLCVAFTTFLCLYGMIWYAEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHASNNESHSSRRRNRHSKSKVTNGVGKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry