AibGenesis™ Mouse Anti-PXMP2 Antibody (CBMOAB-55796FYA)


Cat: CBMOAB-55796FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55796FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO55796FYA 100 µg
CBMOAB-94829FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94829FYA 100 µg
MO-AB-06760H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06760C 100 µg
MO-AB-12907W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12907W 100 µg
MO-AB-18868R Monoclonal Cattle (Bos taurus) WB, ELISA MO18868R 100 µg
MO-AB-28217H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28217C 100 µg
MO-AB-62709W Monoclonal Marmoset WB, ELISA MO62709W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO55796FYA
SpecificityThis antibody binds to Rhesus PXMP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PXMP2 Antibody is a mouse antibody against PXMP2. It can be used for PXMP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPeroxisomal membrane protein 2; PXMP2
UniProt IDH9EWI6
Protein RefseqThe length of the protein is 195 amino acids long.
The sequence is show below: MAPPASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKEHSRSLDVGGPLRYAVYGFFFTGPLSHFFYLFMEHWIPPEVPLAGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAFATKMRGGFWPALRMNWRVWTPVQFININYIPLKFRVLFANLAALFWYAYLASLGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry