AibGenesis™ Mouse Anti-QRFPR Antibody (CBMOAB-55840FYA)


Cat: CBMOAB-55840FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55840FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO55840FYA 100 µg
MO-AB-05475W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05475W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO55840FYA
SpecificityThis antibody binds to Rhesus QRFPR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionReceptor for the orexigenic neuropeptide QRFP. The activity of this receptor is mediated by G proteins that modulate adenylate cyclase activity and intracellular calcium levels. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus QRFPR Antibody is a mouse antibody against QRFPR. It can be used for QRFPR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesQRFPR
UniProt IDF7HNU8
Protein RefseqThe length of the protein is 430 amino acids long.
The sequence is show below: MQVLNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLALVLTGVLIFALALFGNALVFYVVTRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQNISDNWLGGNLFSILLSLLLCQRLVYYIYVIAELSILFYRSIHLFKIMSAFQLYFSFSILCVVWLVAVIVGSPMWHVQQLEIKYDFLYEKEHICCLEEWTSPVHQKIYTTFILVILFLLPLMVMLILYSKIGYELWIKKRVGDGSVLQTIHGKEMSKIARKKKRAVIMMVTVVALFAVCWAPFHVVHMMIEYSNFEKEYDDVTIKMIFAIVQIIGFSNSICNPIVYAFMNENFKKNVLSAVCYCIVNKTFSPAQRHGNSGITMMQKKAKFSLRENPVEETKGETFSDGNIEVKLCEQTKEIKKLKRHLALFRSELAENSTLDSGH.
For Research Use Only | Not For Clinical Use.
Online Inquiry