Mouse Anti-RALGPS2 Antibody (CBMOAB-56018FYA)


Cat: CBMOAB-56018FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56018FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO56018FYA 100 µg
CBMOAB-95213FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95213FYA 100 µg
MO-AB-05513W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05513W 100 µg
MO-AB-15002W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15002W 100 µg
MO-AB-62912W Monoclonal Marmoset WB, ELISA MO62912W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO56018FYA
SpecificityThis antibody binds to Rhesus RALGPS2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RALGPS2 Antibody is a mouse antibody against RALGPS2. It can be used for RALGPS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRas-specific guanine nucleotide-releasing factor RalGPS2; RALGPS2
UniProt IDH9FLE2
Protein RefseqThe length of the protein is 159 amino acids long.
The sequence is show below: YKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKC.
For Research Use Only | Not For Clinical Use.
Online Inquiry