AibGenesis™ Mouse Anti-RAMP2 Antibody (CBMOAB-56025FYA)
Cat: CBMOAB-56025FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-56025FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO56025FYA | 100 µg | ||
| CBMOAB-95221FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO95221FYA | 100 µg | ||
| MO-AB-03680Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03680Y | 100 µg | ||
| MO-AB-13683W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13683W | 100 µg | ||
| MO-AB-19025R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19025R | 100 µg | ||
| MO-AB-28329H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28329C | 100 µg | ||
| MO-AB-28744R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28744R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO56025FYA |
| Specificity | This antibody binds to Rhesus RAMP2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP2) protein, CRLR functions as an adrenomedullin receptor. The RAMP2 protein is involved in core glycosylation and transportation of adrenomedullin receptor to the cell surface. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus RAMP2 Antibody is a mouse antibody against RAMP2. It can be used for RAMP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | RAMP2 |
| UniProt ID | F6UGD5 |
| Protein Refseq | The length of the protein is 143 amino acids long. The sequence is show below: AVLKPHEALAQPLPTTGTTGSEGVTVKNYETAVQCCWNHYKDQMDSIEKDWCDWAMISRPYSTLRECLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry