AibGenesis™ Mouse Anti-RASL11B Antibody (CBMOAB-56093FYA)


Cat: CBMOAB-56093FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56093FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO56093FYA 100 µg
CBMOAB-95329FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95329FYA 100 µg
MO-AB-19074R Monoclonal Cattle (Bos taurus) WB, ELISA MO19074R 100 µg
MO-AB-22699W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22699W 100 µg
MO-AB-28360H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28360C 100 µg
MO-AB-62989W Monoclonal Marmoset WB, ELISA MO62989W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO56093FYA
SpecificityThis antibody binds to Rhesus RASL11B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RASL11B Antibody is a mouse antibody against RASL11B. It can be used for RASL11B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRas-like protein family member 11B; RASL11B
UniProt IDI0FJI5
Protein RefseqThe length of the protein is 248 amino acids long.
The sequence is show below: MRLIQNMCTIAEYPAQGSAAASDCCVGAAGRRLVKIAVVGASGVGQTALVVRFLTKRFIGDYERNAGNLYTRQVQIEGETLAIQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQLHQHVQQLHLGTRLPVVVVANKADLLHIKQVDPQLGLQLASMLGCSFYEVSVSENYSDVYSAFHVLCKEVSHKQQPSSTPEKRRTSLIPRPKSPNMQDLKRRFKQALSAKVRTVTSV.
For Research Use Only | Not For Clinical Use.
Online Inquiry