AibGenesis™ Mouse Anti-RDH11 Antibody (CBMOAB-56275FYA)


Cat: CBMOAB-56275FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56275FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa) WB, ELISA MO56275FYA 100 µg
MO-AB-25980W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25980W 100 µg
MO-AB-28780R Monoclonal Pig (Sus scrofa) WB, ELISA MO28780R 100 µg
MO-AB-63153W Monoclonal Marmoset WB, ELISA MO63153W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa)
CloneMO56275FYA
SpecificityThis antibody binds to Rhesus RDH11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an NADPH-dependent retinal reductase and a short-chain dehydrogenase/reductase. The encoded protein has no steroid dehydrogenase activity. (From NCBI)
Product OverviewMouse Anti-Rhesus RDH11 Antibody is a mouse antibody against RDH11. It can be used for RDH11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRDH11
UniProt IDF7C174
Protein RefseqThe length of the protein is 318 amino acids long.
The sequence is show below: MVELLLLLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGKKVYLACRDVEKGELVAKDIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVTWVSAQARNETIARRLWDVSCDLLGLPMD.
For Research Use Only | Not For Clinical Use.
Online Inquiry