AibGenesis™ Mouse Anti-REPIN1 Antibody (CBMOAB-56332FYA)


Cat: CBMOAB-56332FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56332FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO56332FYA 100 µg
MO-AB-19201R Monoclonal Cattle (Bos taurus) WB, ELISA MO19201R 100 µg
MO-AB-63189W Monoclonal Marmoset WB, ELISA MO63189W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO56332FYA
SpecificityThis antibody binds to Rhesus REPIN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus REPIN1 Antibody is a mouse antibody against REPIN1. It can be used for REPIN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesREPIN1
UniProt IDF7FRF8
Protein RefseqThe length of the protein is 567 amino acids long.
The sequence is show below: MLERRCRGPLAMGPAQARLLSGPSQESPQTLEKEPRRLRQQGTSVAQSGAQAPGRAHRCAHCRRHFSGWVALWLHARRCQARLPLPCPECGSRFRHAPFLALHRQVHAAATPDLGFACHLCGQSFRGWVALVLHLRAHSAAKRPVACPKCERRFWRRKQLRAHLRRCHPPAPEARPFICGNCGRSFAQWDQLVAHKRVHVAEALEEAAAKALGPRPRGRPAVTAPRPGGDAVDRPFQCACCGKRFRHKPNLIAHRRVHTGERPHQCPECGKRFTNKPYLTSHRRIHTGEKPYPCKECGRRFRHKPNLLSHSKIHKRSEGSAQAIPGPGSPQPPAGPQESAAEPTPAAPLKPAQEPPPEAPPEPPQDRAEAPPSLYCCDDCGRSFRLERFLRSHQRQHTGERPFTCAECGKNFGKKTHLVAHSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPDRPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEERLLAHQKKHDV.
For Research Use Only | Not For Clinical Use.
Online Inquiry