AibGenesis™ Mouse Anti-RETNLB Antibody (CBMOAB-56353FYA)


Cat: CBMOAB-56353FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56353FYA Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO56353FYA 100 µg
MO-AB-28434H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28434C 100 µg
MO-AB-28795R Monoclonal Pig (Sus scrofa) WB, ELISA MO28795R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO56353FYA
SpecificityThis antibody binds to Rhesus RETNLB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RETNLB Antibody is a mouse antibody against RETNLB. It can be used for RETNLB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRETNLB
UniProt IDF6WD46
Protein RefseqThe length of the protein is 117 amino acids long.
The sequence is show below: TLTLYRMGPSSCHLLILIPLLQLVIPGSTQCSLDSVMDKKIKDILNRLEYSPSPVSKKLLCTSVKSQGRLASCPAGMSVTGCACGYGCGSWDVQGGTTCHCQCSVMDWTTARCCYLA.
For Research Use Only | Not For Clinical Use.
Online Inquiry