AibGenesis™ Mouse Anti-RNF24 Antibody (CBMOAB-56660FYA)


Cat: CBMOAB-56660FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56660FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO56660FYA 100 µg
CBMOAB-96215FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96215FYA 100 µg
MO-AB-19395R Monoclonal Cattle (Bos taurus) WB, ELISA MO19395R 100 µg
MO-AB-20020W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20020W 100 µg
MO-AB-28561H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28561C 100 µg
MO-AB-63432W Monoclonal Marmoset WB, ELISA MO63432W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO56660FYA
SpecificityThis antibody binds to Rhesus RNF24.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an integral membrane protein that contains a RING-type zinc finger. The encoded protein may interact with multiple transient receptor potential cation channel subfamily C (TRPC) proteins and regulate the trafficking and insertion of these proteins into the plasma membrane. (From NCBI)
Product OverviewMouse Anti-Rhesus RNF24 Antibody is a mouse antibody against RNF24. It can be used for RNF24 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNF24
UniProt IDF6RKJ3
Protein RefseqThe length of the protein is 149 amino acids long.
The sequence is show below: MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAYKQVRNLIQVLNRHLASFLCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGPLPGAENIV.
For Research Use Only | Not For Clinical Use.
Online Inquiry