AibGenesis™ Mouse Anti-RNF25 Antibody (CBMOAB-56661FYA)


Cat: CBMOAB-56661FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56661FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO56661FYA 100 µg
CBMOAB-96217FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96217FYA 100 µg
MO-AB-07181H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07181C 100 µg
MO-AB-12065W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12065W 100 µg
MO-AB-19398R Monoclonal Cattle (Bos taurus) WB, ELISA MO19398R 100 µg
MO-AB-63436W Monoclonal Marmoset WB, ELISA MO63436W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO56661FYA
SpecificityThis antibody binds to Rhesus RNF25.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination. (From NCBI)
Product OverviewMouse Anti-Rhesus RNF25 Antibody is a mouse antibody against RNF25. It can be used for RNF25 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNF25
UniProt IDF7HD77
Protein RefseqThe length of the protein is 362 amino acids long.
The sequence is show below: ILQALGHVKAGLGAAMLYELIEKGKEILTDNNIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELKAQGQEQEQERQHAATKQKEVGVQCPVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLEAERNRYFISLQQPPTPAEPESAVDVSKGSQPPSTLAAELPTSSAVQSTLPTPLPVATQYMCEKIPGAGSNQQRLGETQRAMLDPPKPSRGPWRQPERRHPKGGECHAPKGTRDTQELPPPEGPLKEPVDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRWERSKGRTPGSSYPRLPRGQGAYRPGTRREPLGLESEDGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry