Mouse Anti-RPP21 Antibody (CBMOAB-56796FYA)


Cat: CBMOAB-56796FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56796FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO56796FYA 100 µg
CBMOAB-96486FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96486FYA 100 µg
MO-AB-07269H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07269C 100 µg
MO-AB-12211W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12211W 100 µg
MO-AB-28640H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28640C 100 µg
MO-AB-63550W Monoclonal Marmoset WB, ELISA MO63550W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO56796FYA
SpecificityThis antibody binds to Rhesus RPP21.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RPP21 Antibody is a mouse antibody against RPP21. It can be used for RPP21 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibonuclease P protein subunit p21; RPP21
UniProt IDF7HEN9
Protein RefseqThe length of the protein is 176 amino acids long.
The sequence is show below: MAGPVKDREAFQRLNFLYQVSLRQAPGDGAWRPRVTASLPQAAHCVLAQDPENQALARFYCHTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGNQADSKPLQPLPNTAHSISDHLPEEKMQIQGSSDQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry