AibGenesis™ Mouse Anti-RPRML Antibody (CBMOAB-56811FYA)


Cat: CBMOAB-56811FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56811FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO56811FYA 100 µg
CBMOAB-96502FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96502FYA 100 µg
MO-AB-28644H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28644C 100 µg
MO-AB-63560W Monoclonal Marmoset WB, ELISA MO63560W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO56811FYA
SpecificityThis antibody binds to Rhesus RPRML.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RPRML Antibody is a mouse antibody against RPRML. It can be used for RPRML detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesReprimo-like protein; RPRML
UniProt IDH9FU94
Protein RefseqThe length of the protein is 120 amino acids long.
The sequence is show below: MNATFLNHSGLEEVGGVGGGAGAALGNRTHGLGTWLGCCPGGPPLAASDGVPAGLAPDERSLWVSRVAQIAVLCVLSLTVVFGVFFLGCNLLIKSESMINFLVQERRPSKDVGAAILGLY.
For Research Use Only | Not For Clinical Use.
Online Inquiry