Mouse Anti-RPUSD4 Antibody (CBMOAB-56863FYA)


Cat: CBMOAB-56863FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56863FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO56863FYA 100 µg
CBMOAB-96591FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96591FYA 100 µg
MO-AB-05734W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05734W 100 µg
MO-AB-11022W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11022W 100 µg
MO-AB-19598R Monoclonal Cattle (Bos taurus) WB, ELISA MO19598R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO56863FYA
SpecificityThis antibody binds to Rhesus RPUSD4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RPUSD4 Antibody is a mouse antibody against RPUSD4. It can be used for RPUSD4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRPUSD4
UniProt IDF7HSY0
Protein RefseqThe length of the protein is 377 amino acids long.
The sequence is show below: MAAPRWRASGLWIWGNGQGLESLFSLVSKPFCSAAAASTSVNAQRLAERLRAQKREQDTNKKPVSTNPVQRRVQEIVRFTRQLQRVHPNVLAKALTRGILHQNNNLVVINKPYGLPVHGGPGVQLCISDVLPILAKMLHGHKAEPLHLCHRLDKETTGVMVLAWDKDMAHQVQELFRTRQVVKKYWAITVRVPMPSAGVVDIPIVEKEAQGQQQHHKMTLSPSYRMDNGKMVKVRHSRNAQVAVTRYQVLSSTLSSALVELQPITGIKHQLRVHLSFGLDCPILGDHKYSDWNRLAPQKLSVGTLKKLGLEQSKARYIPLHLHAQQLILPALGSRKEDLNLVCKLPRFFVCSLRRLGLEMPNQDQNENNEAKHLGAQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry