Mouse Anti-RSPO2 Antibody (CBMOAB-56918FYA)
Cat: CBMOAB-56918FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-56918FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO56918FYA | 100 µg | ||
| CBMOAB-96717FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96717FYA | 100 µg | ||
| MO-AB-01526R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01526R | 100 µg | ||
| MO-AB-03872Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03872Y | 100 µg | ||
| MO-AB-07335H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07335C | 100 µg | ||
| MO-AB-19632R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19632R | 100 µg | ||
| MO-AB-22125W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22125W | 100 µg | ||
| MO-AB-28699H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28699C | 100 µg | ||
| MO-AB-38138W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38138W | 100 µg | ||
| MO-AB-46400W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46400W | 100 µg | ||
| MO-AB-63653W | Monoclonal | Marmoset | WB, ELISA | MO63653W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO56918FYA |
| Specificity | This antibody binds to Rhesus RSPO2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the R-spondin family of proteins. These proteins are secreted ligands of leucine-rich repeat containing G protein-coupled receptors that enhance Wnt signaling through the inhibition of ubiquitin E3 ligases. A chromosomal translocation including this locus that results in the formation of a gene fusion has been identified in multiple human cancers. Alternative splicing results in multiple transcript variants. |
| Product Overview | Mouse Anti-Rhesus RSPO2 Antibody is a mouse antibody against RSPO2. It can be used for RSPO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | RSPO2 |
| UniProt ID | F7G147 |
| Protein Refseq | The length of the protein is 243 amino acids long. The sequence is show below: MQFRLFSFALIILNCMDYSHCQGNRWRRSKRVVYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPAKDTIPCPTIAESRRCKMAMRHCPGGKRTPKAKEKRNKKKKRKLIERAQEQHSVFLATDRANQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry