AibGenesis™ Mouse Anti-SAMD12 Antibody (CBMOAB-57089FYA)


Cat: CBMOAB-57089FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57089FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO57089FYA 100 µg
MO-AB-05782W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05782W 100 µg
MO-AB-28806H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28806C 100 µg
MO-AB-63786W Monoclonal Marmoset WB, ELISA MO63786W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO57089FYA
SpecificityThis antibody binds to Rhesus SAMD12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SAMD12 Antibody is a mouse antibody against SAMD12. It can be used for SAMD12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSAMD12
UniProt IDF6QHV5
Protein RefseqThe length of the protein is 196 amino acids long.
The sequence is show below: ALHCGLNPRGIDHPAHAEGIKLQIEGEGVESQSIKNKNFQKVPDQKGTPRRLQAESETAKSATVKLSKPVALWTQQDVCKWLKKHCPNQYQIYSESFKQHDITGRALLRLTDKKLERMGIAQENLRQHILQQVLQLKVREEVRNLQLLTQGTLLLPDGLMEGEMGRKKTLLLGQMEAGENLLFLRRISFLENSTQI.
For Research Use Only | Not For Clinical Use.
Online Inquiry