AibGenesis™ Mouse Anti-SBK3 Antibody (CBMOAB-57145FYA)


Cat: CBMOAB-57145FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57145FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO57145FYA 100 µg
CBMOAB-97128FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97128FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO57145FYA
SpecificityThis antibody binds to Rhesus SBK3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SBK3 Antibody is a mouse antibody against SBK3. It can be used for SBK3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSBK3
UniProt IDF6RUJ7
Protein RefseqThe length of the protein is 293 amino acids long.
The sequence is show below: DTATALQRLVELTASRVTPVRSLRDRYHLIRKLGSGSYGRVLLAQPHQGGPAVALKLLRRDLVPRTTFLREFCVGRCVSAHPGLLQTLAGPLQTPRYFAFAQEYAPCGDLSGMLQERGLLPELLVKRVVAQLAGALDFLHSRGLVHADVKPDNVLVFDPVCSRVALGDLGLTRPEGSPTPAPPGPLPTAPPELCLLLPPDTLPLRPAVDSWGLGVLLFCAATACFPWDVALAPDPEFEAFAGWVTTKPQPPRPPPPWDQFAPPAMALLQGLLDLDPETRSPPLAVLDFLGDNW.
For Research Use Only | Not For Clinical Use.
Online Inquiry