Mouse Anti-SCARF1 Antibody (CBMOAB-57189FYA)


Cat: CBMOAB-57189FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57189FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO57189FYA 100 µg
CBMOAB-97209FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97209FYA 100 µg
MO-AB-05809W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05809W 100 µg
MO-AB-17904W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17904W 100 µg
MO-AB-63878W Monoclonal Marmoset WB, ELISA MO63878W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO57189FYA
SpecificityThis antibody binds to Rhesus SCARF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a scavenger receptor that is expressed in endothelial cells. It regulates the uptake of chemically modified low density lipoproteins, including acetylated low density lipoprotein (Ac-LDL), and it may be involved in atherogenesis. This gene is regulated by the transcription factors ZNF444/EZF-2 and SP1. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus SCARF1 Antibody is a mouse antibody against SCARF1. It can be used for SCARF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSCARF1
UniProt IDF7BU48
Protein RefseqThe length of the protein is 550 amino acids long.
The sequence is show below: MGLGLLLPLLLLWTRGTQGSELDPNGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGPDACQKDEVCVKPGLCRCKPGFFGAYCSSRCPGQYWGPDCRENCPCHPHGQCEPATGACQCQAHRWGAHCEFPCTCGPHGRCDPATGVCRCEPGWWSPTCHRPCQCKPEAARCEQATGACVCKPGWWGRRCSFRCTCHGSPCDQDSGRCACRPGWWGPECRQQCECVRGRCSAASGQCTCPPGFRGARCELPCPAGSHGVQCAHSCGHCKHNEPCSPDTGSCESCEPGWNGTQCQQPCLPGTFGESCGQQCSHCRRGEVCQPDTGHCQRCDPGWLGPRCEDPCPTGTFGEDCGSTCPTCVQGACDAVTGECVCSAGYWGPSCNTSCPAGFHGNNCSVPCECPEGPCHPVSGSCQPGSRSRDATLIASSLVPLLLLFLGLACCACCCWATRSDLKDRPARDRATVSRMKMQVWGTLTSLGSTLPCGSLSSHKLPWVTVSHHDPEVPFNHSFIEPPSAGWASDDSFSSDPESAEADEVPAYCVPPHEGSPPTA.
For Research Use Only | Not For Clinical Use.
Online Inquiry