Mouse Anti-SCGB3A1 Antibody (CBMOAB-57215FYA)


Cat: CBMOAB-57215FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57215FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO57215FYA 100 µg
MO-AB-28852H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28852C 100 µg
MO-AB-63895W Monoclonal Marmoset WB, ELISA MO63895W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO57215FYA
SpecificityThis antibody binds to Rhesus SCGB3A1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SCGB3A1 Antibody is a mouse antibody against SCGB3A1. It can be used for SCGB3A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSCGB3A1
UniProt IDF6YJG8
Protein RefseqThe length of the protein is 121 amino acids long.
The sequence is show below: MKLAAALLGLCVALSCGSAAAFFVGSAKHVAQPVTELESGTEAAAGTLAKPLGTAADPLGAANPLGTLNPLGTLNLLKLLLASLGIPVNHLVEGSQKCVAELGPEAMGALKTLLGVLTMFG.
For Research Use Only | Not For Clinical Use.
Online Inquiry